DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and foxa4

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_988938.1 Gene:foxa4 / 394535 XenbaseID:XB-GENE-486455 Length:399 Species:Xenopus tropicalis


Alignment Length:359 Identity:101/359 - (28%)
Similarity:148/359 - (41%) Gaps:101/359 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 KPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVPRE 149
            |||||||:||||||.|:|:|.:||:.|..:|:..||||:.....|||||||:||.||||:||||.
 Frog   119 KPPYSYISLITMAIQQAPNKMMTLNEIYQWIIDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVPRS 183

  Fly   150 PGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKRAPTMQRFSFPAVFGTLSPFWIRKPVPLVPVH 214
            |..||||::|||.|.:.:||:||.:|||:||:|    .:|                         
 Frog   184 PEKPGKGSYWTLHPESGNMFENGCYLRRQKRFK----CER------------------------- 219

  Fly   215 FNVPNFNGSREFDVVHNPADVFDSALRADKKFNFFANAEASFYQGSQSGDKFDRLPFMNRGRGAD 279
                :.:|.|| ..|:.|.|....:|:           |........|..:..:.|..:.||  |
 Frog   220 ----SKSGERE-KKVNKPGDENGGSLK-----------ETPVGYDDCSSSRSPQAPVNDGGR--D 266

  Fly   280 VLDALPHSSGSGGGVGGGSESSRGSKYKSPYAFDVATVASAAGIPGHRDYAERLSAGGGYMDLNV 344
            ...:..|.:..|..||                  ::..:..||......|...|| ..||  |.:
 Frog   267 STGSSIHQASGGSPVG------------------LSPTSEQAGTASQLMYPLGLS-NDGY--LGL 310

  Fly   345 YNDDADTEAD------------AEAEGDDDSCEDKID--------VESGNEQEDSHISDSVDSAC 389
            ..:|...:.|            ..:...|.:...|::        |...|...|.|     :.|.
 Frog   311 VGEDVHLKHDPFSGRHPFSITQLMSSEQDQTYPSKLEMCPTTDHLVHYSNYSSDYH-----NMAS 370

  Fly   390 TNRLDAPPEALIFEASAEASDSSPRRRFDSEPLV 423
            .|.||.        .::.::|:.......|.|::
 Frog   371 KNGLDM--------QTSSSTDNGYYANMYSRPIL 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 52/85 (61%)
foxa4NP_988938.1 Forkhead_N <25..118 CDD:369872
COG5025 <118..303 CDD:227358 81/248 (33%)
FH 119..207 CDD:214627 53/87 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..290 18/131 (14%)
HNF_C 326..387 CDD:370449 11/73 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.