DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and foxl1

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_957278.1 Gene:foxl1 / 393959 ZFINID:ZDB-GENE-040426-1181 Length:363 Species:Danio rerio


Alignment Length:143 Identity:78/143 - (54%)
Similarity:95/143 - (66%) Gaps:12/143 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 SDIEPSSMGGSGAA-----GGNGDG----SGSSGG---PLVKPPYSYIALITMAILQSPHKKLTL 108
            |.:..|::|.||::     ||...|    .|.:.|   |..||||||||||.|||..:|.|:.||
Zfish    11 SGVAASALGLSGSSLIYVYGGEVGGIIPALGFASGRQEPPQKPPYSYIALIAMAIKNAPDKRATL 75

  Fly   109 SGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGS 173
            |||..|||.|||||.|....|||||||||||||||||||||.|.||||::||||....|||:||:
Zfish    76 SGIYQFIMDRFPYYHDNKQGWQNSIRHNLSLNDCFIKVPREKGRPGKGSYWTLDTKCLDMFENGN 140

  Fly   174 FLRRRKRYKRAPT 186
            :.||:::.:...|
Zfish   141 YRRRKRKCRTQDT 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 62/85 (73%)
foxl1NP_957278.1 FH 52..140 CDD:214627 63/87 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.