DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and Foxl2

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:XP_003750619.1 Gene:Foxl2 / 367152 RGDID:1310041 Length:374 Species:Rattus norvegicus


Alignment Length:317 Identity:103/317 - (32%)
Similarity:122/317 - (38%) Gaps:140/317 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 EPSSMGG------SGAAGGNGDGS----GSSGG-------PLVKPPYSYIALITMAILQSPHKKL 106
            ||....|      ||.|....:.|    |..||       |..||||||:|||.|||.:|..|:|
  Rat     7 EPEDTAGTLLSPESGRAVKEAEASPPSPGKGGGTAPEKPDPAQKPPYSYVALIAMAIRESAEKRL 71

  Fly   107 TLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDN 171
            |||||..:|:::||:|:.....||||||||||||:||||||||.|...|||:|||||..||||:.
  Rat    72 TLSGIYQYIIAKFPFYEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPACEDMFEK 136

  Fly   172 GSFLRRRKRYKRAPTMQRFSFPAVFGTLSPFWIRKPVPLVPVHFNVPNFNGSREFDVVHNPADVF 236
            |:: |||:|.||                 ||  |.|    |.||                     
  Rat   137 GNY-RRRRRMKR-----------------PF--RPP----PAHF--------------------- 156

  Fly   237 DSALRADKKFNFFANAEASFYQGSQSGDKFDRLPFMNRGRGADVLDALPHSSGSGGGVGGGSESS 301
                                                ..|:|.         .|||||.||.....
  Rat   157 ------------------------------------QPGKGL---------FGSGGGAGGCGVPG 176

  Fly   302 RGS---------KY-----------------KSPY-------AFDVATVASAAGIPG 325
            .|:         ||                 ..||       |...|..|:||..||
  Rat   177 AGADGYGYLAPPKYLQSGFLNNSWPLPQPPSPMPYASCQMAAAAAAAAAAAAAAGPG 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 57/85 (67%)
Foxl2XP_003750619.1 FH 50..138 CDD:214627 57/87 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.