DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and FOXK2

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_004505.2 Gene:FOXK2 / 3607 HGNCID:6036 Length:660 Species:Homo sapiens


Alignment Length:485 Identity:129/485 - (26%)
Similarity:175/485 - (36%) Gaps:131/485 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PMHTLHDSVSLSPPLIKSSRGGSSIGNGIGCSASSRTAAADAMSMGCDDSDIEPSSMGGSGAAGG 71
            |:.:...::|.:.....|.||..|.|..:|     |...:| :::..|:|..|    ....|:||
Human   196 PLPSPTGTISAANSCPSSPRGAGSSGYKVG-----RVMPSD-LNLMADNSQPE----NEKEASGG 250

  Fly    72 NGDGSGSSGGPLVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHN 136
            :.....|      ||||||..||..||..:|.|:|||:||...|...:|||:.....||||||||
Human   251 DSPKDDS------KPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHN 309

  Fly   137 LSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKRAPTMQRFSFPAVFGTLSP 201
            ||||..||||||....||||:||.:||.:|......:|.:||.|          ..|.....|.|
Human   310 LSLNRYFIKVPRSQEEPGKGSFWRIDPASESKLIEQAFRKRRPR----------GVPCFRTPLGP 364

  Fly   202 FWIRKPVPLVPVHFNVPNFNG---------SREFDVVHNPADVFDSALRADKKFNFFANAEASFY 257
            ...|. .|..|.|..|.:.:.         |||    .:||.:......|..|....  .||.|.
Human   365 LSSRS-APASPNHAGVLSAHSSGAQTPESLSRE----GSPAPLEPEPGAAQPKLAVI--QEARFA 422

  Fly   258 QGSQSGDKFDRLPFMNRGRGADVLDALPHSSGSGGGVGGGSESSRGSKYKSPYAFDVAT-VASAA 321
            | |..|......|.:     ..|...||.:.                   .|..:.||| |.::.
Human   423 Q-SAPGSPLSSQPVL-----ITVQRQLPQAI-------------------KPVTYTVATPVTTST 462

  Fly   322 GIPG--------HRDYAERLSAGGGYMDLNVYNDDAD---TEA------DAEAEGDDDSCEDKID 369
            ..|.        |:..|..:::..|....|.|.....   |.|      .|||:.:.|..|.|:.
Human   463 SQPPVVQTVHVVHQIPAVSVTSVAGLAPANTYTVSGQAVVTPAAVLAPPKAEAQENGDHREVKVK 527

  Fly   370 VES----GN---------------------------------------EQEDSHISD---SVDSA 388
            ||.    |:                                       .|..:|::.   :|...
Human   528 VEPIPAIGHATLGTASRIIQTAQTTPVQTVTIVQQAPLGQHQLPIKTVTQNGTHVASVPTAVHGQ 592

  Fly   389 CTNRLDAPPEALIFEASAEASDSSPRRRFD 418
            ..|...:|...|...|||.||..:.|...|
Human   593 VNNAAASPLHMLATHASASASLPTKRHNGD 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 48/85 (56%)
FOXK2NP_004505.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
FHA 47..154 CDD:238017
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 85..104
Required for interaction with DVL2 and SUDS3. /evidence=ECO:0000269|PubMed:25805136 129..171
COG5025 <180..577 CDD:227358 116/438 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..260 17/72 (24%)
Forkhead 257..343 CDD:365978 49/91 (54%)
DNA-binding, major groove. /evidence=ECO:0000269|PubMed:16624804 300..318 13/17 (76%)
DNA-binding, minor groove. /evidence=ECO:0000269|PubMed:16624804 328..332 2/3 (67%)
DNA-binding, minor groove. /evidence=ECO:0000269|PubMed:16624804 348..353 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 359..407 12/52 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 610..632 5/13 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.