DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and foxi1

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_859424.1 Gene:foxi1 / 353313 ZFINID:ZDB-GENE-030505-1 Length:377 Species:Danio rerio


Alignment Length:177 Identity:79/177 - (44%)
Similarity:98/177 - (55%) Gaps:15/177 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 STDPMHTLHDSVSLSPPLIKSSRGGSSIGNGIGCSASSRTAAADAMSMGCDDSDIEPSSMGGSGA 68
            ||:|...::.....|.|.:.|..|||.|.:|.|.:               ....:.|.:..||..
Zfish    75 STNPYLWMNSPGITSTPYLSSPNGGSYIQSGFGSN---------------QRQFLPPPTGFGSAD 124

  Fly    69 AGGNGDGSGSSGGPLVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSI 133
            .|.....|......:|:|||||.|||.|||..:..||||||.|..::...||:||.....|||||
Zfish   125 LGWLSISSQQELFKMVRPPYSYSALIAMAIQNAQDKKLTLSQIYQYVADNFPFYKKSKAGWQNSI 189

  Fly   134 RHNLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKR 180
            ||||||||||.||.|:..:|||||:|||||..|.|||||:|.|:|||
Zfish   190 RHNLSLNDCFKKVARDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRKR 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 53/85 (62%)
foxi1NP_859424.1 Forkhead 141..227 CDD:278670 53/85 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.