DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and slp1

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster


Alignment Length:233 Identity:82/233 - (35%)
Similarity:114/233 - (48%) Gaps:44/233 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TDPMHTLHDSV----------SLSPPLIKSSRGGSSIGNGIGCSASSRTAAADAMSMGCDDSDIE 59
            |:|:|..|..|          |.|......||..:.:.:.....:|...   |.:.:..|| ::|
  Fly    32 TEPVHHHHQYVHPYSNSDGELSASEDFDSPSRTSTPMSSAAESLSSQNN---DKLDVEFDD-ELE 92

  Fly    60 PSSMGGSGAAGGNGDGSG--SSGGPLVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYY 122
            ........:..||.....  ::|....||||||.|||.|||..||.::|||:||..::::||||:
  Fly    93 DQLDEDQESEDGNPSKKQKMTAGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYF 157

  Fly   123 KDKFPAWQNSIRHNLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMF--DNGSFLRRRK------ 179
            |.....||||||||||||.||.|:||...:|||||:|.|||.||::|  :....|||:.      
  Fly   158 KANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRKNPGASRT 222

  Fly   180 ---RYKRA---PTM---------QRFSFPAVFGTLSPF 202
               .|::|   |.|         ..:.:|||     ||
  Fly   223 RLAAYRQAIFSPMMAASPYGAPASSYGYPAV-----PF 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 53/87 (61%)
slp1NP_476730.1 FH 120..205 CDD:214627 52/84 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445478
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11829
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
87.880

Return to query results.
Submit another query.