DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and FOXA3

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_004488.2 Gene:FOXA3 / 3171 HGNCID:5023 Length:350 Species:Homo sapiens


Alignment Length:327 Identity:103/327 - (31%)
Similarity:135/327 - (41%) Gaps:80/327 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LSPPLIKSSRGGSSIGNGIGCSASSRTAAADAMSMGCDDSDIEPSSMGGSGAAGGNGDGSGSSGG 81
            |:||...:..|.:..|.|:.                           |||.::|....|.|...|
Human    65 LAPPAPAAPLGPTFPGLGVS---------------------------GGSSSSGYGAPGPGLVHG 102

  Fly    82 ---------PL--VKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRH 135
                     ||  .|||||||:||||||.|:|.|.||||.|..:||..||||::....|||||||
Human   103 KEMPKGYRRPLAHAKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRH 167

  Fly   136 NLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYK----------RAPTMQRF 190
            :||.||||:||.|.|..||||::|.|.|.:.:||:||.:|||:||:|          .|.|..|.
Human   168 SLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLEEKVKKGGSGAATTTRN 232

  Fly   191 SFPAVFGTLSPFWIRKPVPLVPVHFNVPNFNGSREFDVVH--NPAD--------VFDSALRADKK 245
            ...:...|.:|.......|..|.....|...|..:...:.  :||.        .....|:.|..
Human   233 GTGSAASTTTPAATVTSPPQPPPPAPEPEAQGGEDVGALDCGSPASSTPYFTGLELPGELKLDAP 297

  Fly   246 FNFFANAEASFYQGSQSGDKFDRLPFMNRGRGADVLDALPHSSGSGGGVGG-GSESSRGSKYKSP 309
            :||                   ..||......::...|.|......||.|. |.|.  |..|:..
Human   298 YNF-------------------NHPFSINNLMSEQTPAPPKLDVGFGGYGAEGGEP--GVYYQGL 341

  Fly   310 YA 311
            |:
Human   342 YS 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 53/85 (62%)
FOXA3NP_004488.2 FH 117..205 CDD:214627 54/87 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 217..276 9/58 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.