Sequence 1: | NP_523814.1 | Gene: | fd59A / 37631 | FlyBaseID: | FBgn0004896 | Length: | 456 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_068556.2 | Gene: | FOXA2 / 3170 | HGNCID: | 5022 | Length: | 463 | Species: | Homo sapiens |
Alignment Length: | 231 | Identity: | 87/231 - (37%) |
---|---|---|---|
Similarity: | 115/231 - (49%) | Gaps: | 67/231 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 MHTLHDSVSLSPPLIKSSRGGSS---------IGNGIGCSASSRTAAADAMSMGCDDSDIEPSSM 63
Fly 64 GGSGAAGG---------------NGDGSGSSGG-----------PL------------------- 83
Fly 84 --VKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKV 146
Fly 147 PREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYK 182 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fd59A | NP_523814.1 | Forkhead | 85..171 | CDD:278670 | 56/85 (66%) |
FOXA2 | NP_068556.2 | Forkhead_N | 23..164 | CDD:369872 | 23/131 (18%) |
FH_FOXA2 | 163..264 | CDD:410813 | 64/100 (64%) | ||
HNF_C | 380..452 | CDD:401339 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000010 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |