DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and FOXA2

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_068556.2 Gene:FOXA2 / 3170 HGNCID:5022 Length:463 Species:Homo sapiens


Alignment Length:231 Identity:87/231 - (37%)
Similarity:115/231 - (49%) Gaps:67/231 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 MHTLHDSVSLSPPLIKSSRGGSS---------IGNGIGCSASSRTAAADAMSMGCDDSDIEPSSM 63
            |:.::..:|:|...:.|..|..|         :|.|:..|.:..:..|.||           :.|
Human    43 MNGMNTYMSMSAAAMGSGSGNMSAGSMNMSSYVGAGMSPSLAGMSPGAGAM-----------AGM 96

  Fly    64 GGSGAAGG---------------NGDGSGSSGG-----------PL------------------- 83
            |||..|.|               .|..:|:.||           |:                   
Human    97 GGSAGAAGVAGMGPHLSPSLSPLGGQAAGAMGGLAPYANMNSMSPMYGQAGLSRARDPKTYRRSY 161

  Fly    84 --VKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKV 146
              .|||||||:||||||.|||:|.||||.|..:||..||:|:.....|||||||:||.||||:||
Human   162 THAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKV 226

  Fly   147 PREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYK 182
            ||.|..||||:||||.|.:.:||:||.:|||:||:|
Human   227 PRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFK 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 56/85 (66%)
FOXA2NP_068556.2 Forkhead_N 23..164 CDD:369872 23/131 (18%)
FH_FOXA2 163..264 CDD:410813 64/100 (64%)
HNF_C 380..452 CDD:401339
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.