DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and Foxj3

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_001101441.1 Gene:Foxj3 / 313554 RGDID:1311770 Length:622 Species:Rattus norvegicus


Alignment Length:213 Identity:73/213 - (34%)
Similarity:102/213 - (47%) Gaps:51/213 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TSTD--PMHTLHDSVSLSPPLIKSSRGGSSIGNGIGCSASSRTAAADAMSMGCDDSDIEPSSMGG 65
            ||.|  |..|:..::.      ||....::.|.||    |.:.|..|. :...|..:::....| 
  Rat    25 TSMDWLPQLTMRAAIQ------KSDATQNAHGTGI----SKKNALLDP-NTTLDQEEVQQHKDG- 77

  Fly    66 SGAAGGNGDGSGSSGGPLVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQ 130
                               ||||||.:|||.||..||.||:|||.|..:|...||||::....|:
  Rat    78 -------------------KPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWK 123

  Fly   131 NSIRHNLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKRAPTMQRFSFP-- 193
            ||||||||||.||:||||...:||||::|.:|...::     ..|..|.: |||.:::|.|.|  
  Rat   124 NSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKE-----DTLPTRPK-KRARSVERASTPYS 182

  Fly   194 ----------AVFGTLSP 201
                      .:.|:.||
  Rat   183 IDSDSLGMECIISGSASP 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 47/85 (55%)
Foxj3NP_001101441.1 COG5025 <54..345 CDD:227358 63/174 (36%)
FH_FOXJ3 77..155 CDD:410826 47/97 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.