| Sequence 1: | NP_523814.1 | Gene: | fd59A / 37631 | FlyBaseID: | FBgn0004896 | Length: | 456 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001356931.1 | Gene: | fd3F / 31336 | FlyBaseID: | FBgn0264954 | Length: | 764 | Species: | Drosophila melanogaster |
| Alignment Length: | 207 | Identity: | 56/207 - (27%) |
|---|---|---|---|
| Similarity: | 81/207 - (39%) | Gaps: | 75/207 - (36%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 16 SLSPPLIKSSRGGSSIGNGIGCSASSRTAAADAMS-----------------MGCDDSDIEPSSM 63
Fly 64 GGSGAAGGNGDGSGSSGGPLV-------------------------------------------- 84
Fly 85 KPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVPRE 149
Fly 150 PGNPGKGNFWTL 161 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| fd59A | NP_523814.1 | Forkhead | 85..171 | CDD:278670 | 34/77 (44%) |
| fd3F | NP_001356931.1 | Forkhead | 401..473 | CDD:333958 | 34/75 (45%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR11829 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.010 | |||||