DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and Foxs1

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_001012091.1 Gene:Foxs1 / 311547 RGDID:1310679 Length:327 Species:Rattus norvegicus


Alignment Length:319 Identity:104/319 - (32%)
Similarity:127/319 - (39%) Gaps:91/319 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 KPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVPRE 149
            ||||||||||.|||..||.::.|||||..:||.||.:|:...|.||||||||||||:||:||||:
  Rat    18 KPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNLSLNECFVKVPRD 82

  Fly   150 PGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKRAPTMQRFSFP-------------------AV 195
            ...||||::|||||...|||.:|||||||:|:.:....|....|                   ..
  Rat    83 DRKPGKGSYWTLDPDCHDMFQHGSFLRRRRRFTKRTGAQGTKGPVKADHRPLRATSPDQGAPNTT 147

  Fly   196 FGTLSPF--------------------------WIRKPVPLVPVHFNVPNFNGSREFDVVHNPAD 234
            .|.|.||                          ..|..:|..|.........|.||.....:|:.
  Rat   148 TGRLCPFPPEVPNPKGFGGLMGSLPANMCPTTSDTRPQLPTGPKDMCSAKSGGPRELSEATSPSP 212

  Fly   235 V----FDSALRADKKFNFFANAEA---------------SFYQGSQSGDKFDRLPFMNRGRGADV 280
            .    |.||         |:.||:               |.||        .|:..:|...||| 
  Rat   213 CPAFGFSSA---------FSEAESLGKAPTPSVAPESIGSSYQ--------CRMQTLNFCMGAD- 259

  Fly   281 LDALPHSSGSGGGVGGGSESSRGSKYKSPYAFDVATVASAAGIPGHRDYAERLSAGGGY 339
             ..|.|...|.....|.|..|...:...|...|........|.|        :..|.||
  Rat   260 -PGLEHLLTSAVATPGSSTPSASHRAPLPLPADSKEPWVPGGFP--------VQGGSGY 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 56/85 (66%)
Foxs1NP_001012091.1 Forkhead 18..103 CDD:278670 55/84 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.