DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and Foxe3

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_056573.1 Gene:Foxe3 / 30923 MGIID:1353569 Length:288 Species:Mus musculus


Alignment Length:188 Identity:94/188 - (50%)
Similarity:110/188 - (58%) Gaps:33/188 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 DIEPSSMGGSGAAGGNGDGSGSSGGPLV--KPPYSYIALITMAILQSPHKKLTLSGICDFIMSRF 119
            |.||:::.|.|.....         ||.  ||||||||||.||:..:|.::|||:.|..||..||
Mouse    43 DAEPTAVPGPGKRRRR---------PLQRGKPPYSYIALIAMALAHAPGRRLTLAAIYRFITERF 98

  Fly   120 PYYKDKFPAWQNSIRHNLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKRA 184
            .:|:|....|||||||||:|||||:|||||||||||||:|||||.|.||||||||||||||:|||
Mouse    99 AFYRDSPRKWQNSIRHNLTLNDCFVKVPREPGNPGKGNYWTLDPAAADMFDNGSFLRRRKRFKRA 163

  Fly   185 PTMQRFSFPAVFGTLSPFWIRKPVPLVPVHFNVPNFNGSREFDVVHNPADVF--DSAL 240
                  ..||......|| ...|.|..|...:.|             ||.:|  ||.|
Mouse   164 ------ELPAPPPPPPPF-PYAPFPPPPAPASAP-------------PARLFRLDSLL 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 59/85 (69%)
Foxe3NP_056573.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62 7/27 (26%)
FH 64..152 CDD:214627 61/87 (70%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..189 8/32 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.