DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and foxd3

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_571365.2 Gene:foxd3 / 30548 ZFINID:ZDB-GENE-980526-143 Length:371 Species:Danio rerio


Alignment Length:219 Identity:116/219 - (52%)
Similarity:134/219 - (61%) Gaps:46/219 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GGSSIGNGIGCSA-SSRTAAADAMSMGCD----DSDIEPSSMGGSG------------------A 68
            ||:|..|..|.:. ::.....|.:..|.:    |||.|...|...|                  .
Zfish     5 GGTSASNMSGQTVLTADDVDIDVVGEGDEGMEQDSDCESQCMQDRGDEVEEIEVKERSDSPCESN 69

  Fly    69 AGG--NGDGSGSSGGP--------LVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYK 123
            |.|  .||...||.||        ||||||||||||||||||||.|||||||||:||.:|||||:
Zfish    70 ADGETKGDAQESSTGPMQNKPKSSLVKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYR 134

  Fly   124 DKFPAWQNSIRHNLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKR----- 183
            :|||||||||||||||||||:|:|||||||||||:|||||.:|||||||||||||||:||     
Zfish   135 EKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNGSFLRRRKRFKRHQPDI 199

  Fly   184 -----APTMQRFSFPAVFGTLSPF 202
                 |..||.|   ..:|..:|:
Zfish   200 LRDQTALMMQSF---GAYGIGNPY 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 74/85 (87%)
foxd3NP_571365.2 Forkhead 96..182 CDD:278670 74/85 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 170 1.000 Domainoid score I3728
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm26518
orthoMCL 1 0.900 - - OOG6_108564
Panther 1 1.100 - - LDO PTHR11829
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 1 1.000 - - X1212
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.810

Return to query results.
Submit another query.