DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and Foxk1

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_001032296.2 Gene:Foxk1 / 304298 RGDID:1309643 Length:719 Species:Rattus norvegicus


Alignment Length:411 Identity:116/411 - (28%)
Similarity:156/411 - (37%) Gaps:116/411 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PMHTLHDSVS--------------LSPPLIKSSRGGSSIGNGIGCSASSRTAAADAMSMGCD-DS 56
            |:..|:..:|              :||  |.|..|..|:.|  .|.||.|.|.:.:.....: .|
  Rat   200 PLRPLYPQISPLKIHIPEPDLRSLVSP--IPSPTGTISVPN--SCPASPRGAGSSSYRFVQNVTS 260

  Fly    57 DIE-PSSMGGSGAAGGNGDGS-GSSGGPLVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRF 119
            |:: .:......|:....|.| |.|.....||||||..||..||..:..::||||||...|...:
  Rat   261 DLQLAAEFAAKAASEQQADTSGGDSPKDESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHY 325

  Fly   120 PYYKDKFPAWQNSIRHNLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKRA 184
            |||:.....||||||||||||..||||||....||||:||.:||.:|......:|.:||:|    
  Rat   326 PYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQR---- 386

  Fly   185 PTMQRFSFPAVFGTLSPFWIRKPVPLVPVHFNV--PNFNG-------SREFDVVHNPADVFDSAL 240
             .:..|..|  ||.||    .:..|..|.|..:  |..:|       |||...:.:..|: .|.|
  Rat   387 -GVSCFRTP--FGPLS----SRSAPASPTHPGLMSPRSSGLQTPECLSREGSPIPHDPDL-GSKL 443

  Fly   241 RADKKFNFFANAEASFYQGSQSGDKFDRLPFM---------------------------NRGRGA 278
            .:..::.         |..|..|......|.:                           ..|...
  Rat   444 ASVPEYR---------YSQSAPGSPVSAQPVIMAVPPRPSNLVAKPVAYMPASIVTSQQPSGHAI 499

  Fly   279 DVLDALP---------HSSGSGGGVGGGSESS-------------------RGSKYKSPYAFD-- 313
            .|:...|         .|:.|..|....|:.|                   ||.:.|...||.  
  Rat   500 HVVQQAPTVTMVRVVTTSANSANGYILASQGSTATSHDTAGTAVLDLGNEARGLEEKPTIAFATI 564

  Fly   314 ------VATVAS--AAGIPGH 326
                  :.||||  |.|:|||
  Rat   565 PAASRVIQTVASQMAPGVPGH 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 47/85 (55%)
Foxk1NP_001032296.2 FHA <88..190 CDD:224630
FHA 96..189 CDD:238017
Forkhead 291..377 CDD:278670 47/85 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.