DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and foxg1a

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_571142.1 Gene:foxg1a / 30274 ZFINID:ZDB-GENE-990415-267 Length:420 Species:Danio rerio


Alignment Length:231 Identity:88/231 - (38%)
Similarity:116/231 - (50%) Gaps:47/231 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ASSRTAAADAMSMGCDDSDIEPSSMGG-SGAAGGNGDGSGSSGGPLVKPPYSYIALITMAILQSP 102
            |.|..::.|:.|  .|:.:.:...... .|..|..||   ...|...|||:||.|||.|||.|||
Zfish    71 AKSDNSSHDSSS--TDEKEKQEEKRDAKEGEGGKEGD---KKNGKYEKPPFSYNALIMMAIRQSP 130

  Fly   103 HKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVPREPGNPGKGNFWTLDPLAED 167
            .|:|||:||.:|||..||||::....||||||||||||.||:||||...:|||||:|.|||.::|
Zfish   131 EKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDD 195

  Fly   168 MFDNGSF--LRRRKRYKRAP---------TMQRFSFPAVFGTLSPFWIRKPVPLVPVHFNVPNFN 221
            :|..|:.  ||||....||.         |....:|....|:|  :|     |:.|         
Zfish   196 VFIGGTTGKLRRRSTTSRAKLAFKRGARLTSTGLTFMDRAGSL--YW-----PMSP--------- 244

  Fly   222 GSREFDVVHNPADVFDSALRADKKFNFFANAEASFY 257
                |..:|:|        ||....::  |..:|.|
Zfish   245 ----FLSLHHP--------RASSALSY--NGASSAY 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 56/85 (66%)
foxg1aNP_571142.1 FH 113..201 CDD:214627 56/87 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.