DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and Foxh1

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:XP_008763787.1 Gene:Foxh1 / 300054 RGDID:1311275 Length:416 Species:Rattus norvegicus


Alignment Length:265 Identity:68/265 - (25%)
Similarity:108/265 - (40%) Gaps:66/265 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 KPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVPRE 149
            ||||:|:|:|.:.|.|              :.:.||:::|.:..|::|||||||.|.||.|||::
  Rat    93 KPPYTYLAMIALIIRQ--------------VQAVFPFFRDDYEGWKDSIRHNLSSNRCFRKVPKD 143

  Fly   150 PGNP-GKGNFWTLD----PLAEDMFDNGSFLRRRKRYKRAPTMQRFSFPAVFGTLSPFWI----- 204
            |..| .|||||.:|    |.......|.:..|   |::...|.:.|:     ..|||:.:     
  Rat   144 PAKPQAKGNFWAVDVSLIPAEALRLQNTALCR---RWQNRGTHRAFA-----KDLSPYVLHGQPY 200

  Fly   205 RKPVPLVPVH--FNVPNFNG---------------------------SREFDVVHNPADVFDSAL 240
            |.|.|..|..  |::.:..|                           ..|..:...|::|.|..|
  Rat   201 RPPSPPPPSREDFSIKSLLGDPGKASTWPQHPRLAGQSTPAQASTLSKGEEGIGAGPSNVSDKPL 265

  Fly   241 RADKKFNFFANAEASFYQGSQSGDKFDRLPFMNRGRGADVLDALPHSSGSGGGVGGGSESSRGSK 305
                 :...:....:..:|..|..:..|...::..:|:..|..|..||.|.|....||.:|...:
  Rat   266 -----WPLSSLPRPTRIEGETSQGEVIRPSPVSSDQGSWPLHLLQDSSDSMGMSRRGSRASLWGQ 325

  Fly   306 YKSPY 310
            ..:.|
  Rat   326 LPTSY 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 35/90 (39%)
Foxh1XP_008763787.1 FH 93..157 CDD:294049 33/77 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.