DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and FOXB1

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_036314.2 Gene:FOXB1 / 27023 HGNCID:3799 Length:325 Species:Homo sapiens


Alignment Length:262 Identity:97/262 - (37%)
Similarity:121/262 - (46%) Gaps:45/262 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 KPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVPRE 149
            |||||||:|..|||..||.|.|.||.|..|||.|||||::....||||:|||||.||||||:||.
Human    13 KPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPRR 77

  Fly   150 PGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYK------RAPTMQ-------------RFSFPAV 195
            |..||||:||.|.|...|||:||||||||||:|      .||:..             |.|..|.
Human    78 PDQPGKGSFWALHPSCGDMFENGSFLRRRKRFKVLKSDHLAPSKPADAAQYLQQQAKLRLSALAA 142

  Fly   196 FGTLSPFWIRKPVPLVPVHFNVPNFNGSREFDVVHNPADVFDSALRADK-----KFNFFANAEAS 255
            .||        .:|.:|.  ...|..|..:.....:|..:.:...|..|     .|:......|:
Human   143 SGT--------HLPQMPA--AAYNLGGVAQPSGFKHPFAIENIIAREYKMPGGLAFSAMQPVPAA 197

  Fly   256 FYQGSQSGDKFDRLPFMNRGRGADVLDALPHSSGSGGGVGGGSESSRGSKYKSPYAFDVATVASA 320
            :           .||......|:.:....||..||.|.:...:..|..|...|.|...:..:..|
Human   198 Y-----------PLPNQLTTMGSSLGTGWPHVYGSAGMIDSATPISMASGDYSAYGVPLKPLCHA 251

  Fly   321 AG 322
            ||
Human   252 AG 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 55/85 (65%)
FOXB1NP_036314.2 FH_FOXB2 1..110 CDD:410817 65/96 (68%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 284..325
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.