DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and Foxi2

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_899016.2 Gene:Foxi2 / 270004 MGIID:3028075 Length:311 Species:Mus musculus


Alignment Length:196 Identity:88/196 - (44%)
Similarity:107/196 - (54%) Gaps:23/196 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PPLIKSSRGGSSIGNG----IGCSASS----RTAAADAMSMGCDDSDIEPSSMGGSGAAGGNGDG 75
            ||    |.|.:.:.:|    :..:|.|    .|....|.|.......:..|.:|.||...|....
Mouse    24 PP----SYGRTDLSSGRRLWVNSAALSPAPYATGPGPAPSYAAATLAVPGSLLGASGGLAGADLA 84

  Fly    76 SGSSGGP-----LVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRH 135
            ..|..|.     ||:|||||.|||.|||..:|.::||||.|..::...||:||.....|||||||
Mouse    85 WLSLSGQQELLRLVRPPYSYSALIAMAIQSAPLRRLTLSQIYQYVAGNFPFYKRSKAGWQNSIRH 149

  Fly   136 NLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKRAPTMQRFSFPAVFGTLS 200
            ||||||||.||||:..:|||||:|||||..|.|||||:|  ||||.:|..|    |..||.|..|
Mouse   150 NLSLNDCFKKVPRDENDPGKGNYWTLDPNCEKMFDNGNF--RRKRRRRGET----SEAAVPGASS 208

  Fly   201 P 201
            |
Mouse   209 P 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 53/85 (62%)
Foxi2NP_899016.2 Forkhead 99..184 CDD:333958 52/84 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 188..237 13/28 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 263..294
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.