DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and fhl1

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_594272.1 Gene:fhl1 / 2541552 PomBaseID:SPAC1142.08 Length:743 Species:Schizosaccharomyces pombe


Alignment Length:204 Identity:71/204 - (34%)
Similarity:98/204 - (48%) Gaps:35/204 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 HTSTDPMHTL--------HDSVS------LSP-PLIKSSRGGSSIGNGIGCSASSRTAAADAMSM 51
            |......|||        |.:||      ||| |.::.:.....|......||.......:.:..
pombe   200 HPDAANAHTLASLNQPPKHLTVSPSSIQRLSPQPYVRPTSDERPIETDSSVSAPKVANHDEELKQ 264

  Fly    52 G----CDDSDIEPSSMGGSGAAGGNGDGSGSSGGPLVKPPYSYIALITMAILQSPHKKLTLSGIC 112
            |    ..|:.:.|..           :||..:|....||..||..||...::.:|:||:||..||
pombe   265 GKSTSPSDTVLHPDL-----------NGSPDTGDATQKPNLSYANLIARTLIANPNKKMTLGDIC 318

  Fly   113 DFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLRR 177
            ::|.:.:.||:.:.|||.||||||||||..||::||....||||:||.|||...|.|: |:|.||
pombe   319 EWIANNWSYYRHQPPAWHNSIRHNLSLNKAFIRIPRRQNEPGKGSFWMLDPSYIDQFE-GNFFRR 382

  Fly   178 RKRYKRAPT 186
            .|:    ||
pombe   383 TKK----PT 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 44/85 (52%)
fhl1NP_594272.1 COG5025 1..564 CDD:227358 71/204 (35%)
FHA <38..119 CDD:238017
Forkhead 291..376 CDD:278670 43/84 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 101 1.000 Domainoid score I1793
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm47190
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.