DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and sep1

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_596301.1 Gene:sep1 / 2540866 PomBaseID:SPBC4C3.12 Length:663 Species:Schizosaccharomyces pombe


Alignment Length:347 Identity:83/347 - (23%)
Similarity:136/347 - (39%) Gaps:115/347 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 KPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVPRE 149
            ||||||..||.|:|::||.::||||.|.|:|.:.|.:|......||||||||||||..|:|:.|.
pombe   128 KPPYSYAMLIGMSIIRSPDRRLTLSAIYDWISNTFSFYNKSNNGWQNSIRHNLSLNKAFMKIERP 192

  Fly   150 PGNPGKGNFWTLDPLAEDMFDNGSFLRRRK---RYKRAPTMQRFSFPAVFGTLSPFWIRKPVPLV 211
            ...||||:||::.|..|:.|..   |:.||   ..:.||.:|..:....:|:.:           
pombe   193 RNLPGKGHFWSIRPGHEEQFLK---LKLRKPGVNSRPAPPVQDVTSSTKYGSST----------- 243

  Fly   212 PVHFNVPNFNGSREFDVVHNPADVFDSALRADKKFNFFANAEASFYQGSQSGDKFDRLPFMNRGR 276
                      ||..|:..:....:|      :::..:..|    :|..|.:              
pombe   244 ----------GSSGFNTFNTSPHIF------NQRHQYLQN----YYTASLT-------------- 274

  Fly   277 GADVLDALPHSSGSGGGVGGGSESSRGSKYKSPYAFDVATVASAAGIPGHRDYAERLSAGGGYMD 341
                                                ::.|:::......|..::::     .|:|
pombe   275 ------------------------------------NIPTISNVNATNFHPLHSQQ-----PYVD 298

  Fly   342 LNVYNDDADTEADAEAEGDDDSCEDKIDVESGNEQEDSHISDSVDSACTNRLDAPPEALIFEASA 406
                ....|..:|.||:..|......:.|.|..:            :|||. .:||      .|:
pombe   299 ----TPGIDAPSDLEAKFSDLGVSSVVSVTSPLQ------------SCTNS-PSPP------LSS 340

  Fly   407 EASDSSPRRRFDSEPLVLRTSK 428
            .||.:||.....:|.|.::::|
pombe   341 PASSASPSESLRNESLGIKSAK 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 45/85 (53%)
sep1NP_596301.1 COG5025 20..663 CDD:227358 83/347 (24%)
Forkhead 128..214 CDD:278670 45/85 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm47190
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11829
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.