DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and Foxa3

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:XP_038957314.1 Gene:Foxa3 / 25100 RGDID:2809 Length:361 Species:Rattus norvegicus


Alignment Length:136 Identity:69/136 - (50%)
Similarity:87/136 - (63%) Gaps:16/136 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 MGGSGAAGGNGDGSGSSGGPLV----------------KPPYSYIALITMAILQSPHKKLTLSGI 111
            :|.....||:..|.|:.|..||                |||||||:||||||.|:|.|.||||.|
  Rat    88 LGAGSGTGGSASGYGAPGPGLVHGKEMAKGYRRPLAHAKPPYSYISLITMAIQQAPGKMLTLSEI 152

  Fly   112 CDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLR 176
            ..:||..||||::....|||||||:||.||||:||.|.|..||||::|.|.|.:.:||:||.:||
  Rat   153 YQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCYLR 217

  Fly   177 RRKRYK 182
            |:||:|
  Rat   218 RQKRFK 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 53/85 (62%)
Foxa3XP_038957314.1 FH_FOXA3 124..225 CDD:410814 61/100 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.