DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and Foxi2

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:XP_341950.2 Gene:Foxi2 / 246073 RGDID:621739 Length:337 Species:Rattus norvegicus


Alignment Length:301 Identity:108/301 - (35%)
Similarity:141/301 - (46%) Gaps:55/301 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PPLIKSSRGGSSIGNG----IGCSASS-----------RTAAADAMSMGCDDSDIEPSSMGGSGA 68
            ||    |.|.:.:|:|    :..:|.|           .|.||.|:::  ..|.:.||    .|.
  Rat    50 PP----SYGRADLGSGRRLWVNSTALSPAPYTPGPGPAPTYAAAALAV--SGSLLSPS----GGL 104

  Fly    69 AGGNGDGSGSSGGP----LVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAW 129
            ||.:......||..    ||:|||||.|||.|||..:|.::||||.|..::...||:||.....|
  Rat   105 AGADLAWLSLSGQQELLRLVRPPYSYSALIAMAIQSAPLRRLTLSQIYQYVAGNFPFYKRSKAGW 169

  Fly   130 QNSIRHNLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKRAPTMQRFSFPA 194
            ||||||||||||||.||||:..:|||||:|||||..|.|||||:|  ||||.:|..|    |..|
  Rat   170 QNSIRHNLSLNDCFKKVPRDENDPGKGNYWTLDPNCEKMFDNGNF--RRKRRRRGET----SEAA 228

  Fly   195 VFGTLSPFWIRKPVPLVPVHFNVPNFNGSREFDVVHNPADVFDSALRADKKFNFFANAEASFYQG 259
            |.|...|    :...|.|        :|....|:..:|:.....|......|:....|.|..:..
  Rat   229 VPGASRP----ERAALEP--------SGLVSQDLQTSPSPTAPEAAACLSSFSTALGALAGGFST 281

  Fly   260 SQSGDKFD---RLPFMNRGRGADVLDALP-----HSSGSGG 292
            ...|...|   |.|.....|...:.:..|     |.:|:.|
  Rat   282 LPDGLPQDFSLRRPPTESSRRPQIPNTSPGFGPGHQTGATG 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 53/85 (62%)
Foxi2XP_341950.2 Forkhead 125..211 CDD:278670 53/85 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.