DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and FOXM1

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_973731.1 Gene:FOXM1 / 2305 HGNCID:3818 Length:801 Species:Homo sapiens


Alignment Length:169 Identity:57/169 - (33%)
Similarity:77/169 - (45%) Gaps:46/169 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 KPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKD-KFPAWQNSIRHNLSLNDCFIKVPR 148
            :|||||:|:|..||..:..|::||..|..:|...|||:|. ..|.|:|||||||||:|.|:   |
Human   236 RPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFV---R 297

  Fly   149 EPGNPGKGNFWTLDPLA------EDMF---DNGS----------------FLRRR---------- 178
            |....||.:|||:.|.|      :.:|   |.||                .|||.          
Human   298 ETSANGKVSFWTIHPSANRYLTLDQVFKPLDPGSPQLPEHLESQQKRPNPELRRNMTIKTELPLG 362

  Fly   179 KRYKRAPTMQRFS-------FPAVFGTLSPFWIRKPVPL 210
            .|.|..|.:.|.|       ||.....:....::.|:||
Human   363 ARRKMKPLLPRVSSYLVPIQFPVNQSLVLQPSVKVPLPL 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 41/95 (43%)
FOXM1NP_973731.1 FH 236..311 CDD:238016 38/77 (49%)
Herpes_ICP4_C 504..>749 CDD:332854
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.