DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and FOXC2

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_005242.1 Gene:FOXC2 / 2303 HGNCID:3801 Length:501 Species:Homo sapiens


Alignment Length:363 Identity:123/363 - (33%)
Similarity:162/363 - (44%) Gaps:100/363 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 SRTAAADAMSMGCDDSDIEPSSMGGSGAAGGNGD--------------GSGSSGGP--------- 82
            :|.:.:|..::|......|.:....:|:.||...              |.|.|..|         
Human     3 ARYSVSDPNALGVVPYLSEQNYYRAAGSYGGMASPMGVYSGHPEQYSAGMGRSYAPYHHHQPAAP 67

  Fly    83 --LVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIK 145
              ||||||||||||||||..:|.||:||:||..|||.|||:|::....||||||||||||:||:|
Human    68 KDLVKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNECFVK 132

  Fly   146 VPREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKRAPTMQRFSFPAVFGTLSPFWIRKPVPL 210
            |||:...||||::|||||.:.:||:||||||||:|:|:....:.....|......|. ..|..|.
Human   133 VPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVSKEKEERAHLKEPPPA-ASKGAPA 196

  Fly   211 VPVHFNVPNFNGSREFDVV-----HNPA-DVF--------DSALRADKKFNFFANAEASFYQGSQ 261
            .|...:.|.   ..|..||     .:|| .|.        :|||:...:      :.||...||.
Human   197 TPHLADAPK---EAEKKVVIKSEAASPALPVITKVETLSPESALQGSPR------SAASTPAGSP 252

  Fly   262 SGDKFDRLPFMNRGRGADVLDALP-HSSGSGGGVGG--------------GSESSRGS------- 304
            .|                   :|| |.:.:..|:.|              |.|.|.|:       
Human   253 DG-------------------SLPEHHAAAPNGLPGFSVENIMTLRTSPPGGELSPGAGRAGLVV 298

  Fly   305 -KYKSPYAFDVATVASAAGIPGHRDYAERLSAG--GGY 339
             ....|||   |...:|.|.|    .|:.|.||  |||
Human   299 PPLALPYA---AAPPAAYGQP----CAQGLEAGAAGGY 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 57/85 (67%)
FOXC2NP_005242.1 FH 72..160 CDD:214627 58/87 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..208 8/44 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 232..268 12/60 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 383..420
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.