DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and FOXL1

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_005241.1 Gene:FOXL1 / 2300 HGNCID:3817 Length:345 Species:Homo sapiens


Alignment Length:282 Identity:103/282 - (36%)
Similarity:134/282 - (47%) Gaps:78/282 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 SGSSGGPLVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLN 140
            ||.:..| .||||||||||.|||..:|.:::||:||..|||.|||:|.|....||||||||||||
Human    41 SGRAETP-QKPPYSYIALIAMAIQDAPEQRVTLNGIYQFIMDRFPFYHDNRQGWQNSIRHNLSLN 104

  Fly   141 DCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYK-----------RAPTMQRF---- 190
            |||:|||||.|.||||::|||||...|||:||::.||:::.|           ||.|.||.    
Human   105 DCFVKVPREKGRPGKGSYWTLDPRCLDMFENGNYRRRKRKPKPGPGAPEAKRPRAETHQRSAEAQ 169

  Fly   191 ---------SFPAVF------GTLSPFWIRKPVPLVPVHFNVPNFNGSREFDVVHNPADVFDSAL 240
                     |.||:.      ...||. :..|.|..|:|:  |......|        |..|:|.
Human   170 PEAGSGAGGSGPAISRLQAAPAGPSPL-LDGPSPPAPLHW--PGTASPNE--------DAGDAAQ 223

  Fly   241 RADKKFNFFANAEASFYQGSQSGDKFDRLPFMNRGRGADVLDALPHSSGSGGGVGGGSESSRGSK 305
            .|         |..:..|.:::||                        |.|..:...|.||..|.
Human   224 GA---------AAVAVGQAARTGD------------------------GPGSPLRPASRSSPKSS 255

  Fly   306 YKSPYAFDVATVASAAGIPGHR 327
            .||. :|.:.::  .||..|.:
Human   256 DKSK-SFSIDSI--LAGKQGQK 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 59/85 (69%)
FOXL1NP_005241.1 FH 49..137 CDD:214627 60/87 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..289 40/186 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.