DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and FOXD1

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_004463.1 Gene:FOXD1 / 2297 HGNCID:3802 Length:465 Species:Homo sapiens


Alignment Length:395 Identity:148/395 - (37%)
Similarity:177/395 - (44%) Gaps:129/395 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DSVSLSPPLIKSSRGGSSIGNGIGCSASSRTAAADAMSMGCDDSDIEPSSMGGSGAAGGNGDGSG 77
            |.:.|:||     .|||....|                         |:...|:||.||.|.|..
Human    75 DDILLAPP-----AGGSPAPPG-------------------------PAPAAGAGAGGGGGGGGA 109

  Fly    78 SSGG--------PLVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIR 134
            ..||        |||||||||||||||||||||.|:||||.||:||..|||||::||||||||||
Human   110 GGGGSAGSGAKNPLVKPPYSYIALITMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIR 174

  Fly   135 HNLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKRAPTMQRFSF------- 192
            |||||||||:|:|||||||||||:|||||.:.||||||||||||||:||.|.:...:.       
Human   175 HNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGSFLRRRKRFKRQPLLPPNAAAAESLLL 239

  Fly   193 -----------PAVFGTLSPFWIRKPVPLVPVH------------FNVPNFNGSREFDVVHNPAD 234
                       ||....|.|     |.|..|.|            ..:|.:         ..|:.
Human   240 RGAGAAGGAGDPAAAAALFP-----PAPPPPPHAYGYGPYGCGYGLQLPPY---------APPSA 290

  Fly   235 VFDSALRADKKFNFFANAEASFYQGSQ--------SGDKFDRLPFMNRGR--GADVLDALPHSSG 289
            :|.:|..        |.|.|:|:..|.        :..:..|..|..|..  ||.:...||.|:.
Human   291 LFAAAAA--------AAAAAAFHPHSPPPPPPPHGAAAELARTAFGYRPHPLGAALPGPLPASAA 347

  Fly   290 SGGGVGGGS--------ESSRGSKYKSPYAFDVATVASAAG-------------IPGHRDYAERL 333
            ..||.|..:        ||..|.......|...|..|:||.             .||        
Human   348 KAGGPGASALARSPFSIESIIGGSLGPAAAAAAAAQAAAAAQASPSPSPVAAPPAPG-------- 404

  Fly   334 SAGGG 338
            |:|||
Human   405 SSGGG 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 71/85 (84%)
FOXD1NP_004463.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..117 18/71 (25%)
Forkhead 125..211 CDD:278670 71/85 (84%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 391..410 6/27 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 170 1.000 Domainoid score I3773
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1212
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.