DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and FOXC1

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_001444.2 Gene:FOXC1 / 2296 HGNCID:3800 Length:553 Species:Homo sapiens


Alignment Length:440 Identity:127/440 - (28%)
Similarity:171/440 - (38%) Gaps:182/440 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 PSSMG-------------GSGAAGGNG---------------------DGSGSSGGP-------- 82
            |:|:|             .:.||.|.|                     .|...:.||        
Human    10 PNSLGVVPYLGGEQSYYRAAAAAAGGGYTAMPAPMSVYSHPAHAEQYPGGMARAYGPYTPQPQPK 74

  Fly    83 -LVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKV 146
             :|||||||||||||||..:|.||:||:||..|||.|||:|:|....||||||||||||:||:||
Human    75 DMVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRDNKQGWQNSIRHNLSLNECFVKV 139

  Fly   147 PREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKR---------------------------A 184
            ||:...||||::|||||.:.:||:||||||||:|:|:                           |
Human   140 PRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDAVKDKEEKDRLHLKEPPPPGRQPPPA 204

  Fly   185 PTMQR------------------------------FSFPAVFGTLSPFWIRK------------- 206
            |..|.                              .|..|..|:.|...:.|             
Human   205 PPEQADGNAPGPQPPPVRIQDIKTENGTCPSPPQPLSPAAALGSGSAAAVPKIESPDSSSSSLSS 269

  Fly   207 ----------------------PVPLVPVHFNVPNFNGSREFDVVHNPADVFDSALR-------A 242
                                  |.|..|   :.|..:.|:.|.|     |...::||       |
Human   270 GSSPPGSLPSARPLSLDGADSAPPPPAP---SAPPPHHSQGFSV-----DNIMTSLRGSPQSAAA 326

  Fly   243 DKKFNFFANAEASFYQGSQSGDKFDRLPFMNRGR---GADVLDALP----HSSGSGGGVGGGSES 300
            :......|:|.||    |::|    ..|.:..|.   |...|.:.|    .|:||.||.|||:.:
Human   327 ELSSGLLASAAAS----SRAG----IAPPLALGAYSPGQSSLYSSPCSQTSSAGSSGGGGGGAGA 383

  Fly   301 SRGSKYKSPYAFDVATVASAA---------GIPGHRDYAERLSAGGGYMD 341
            :.|:.....|..::..::..|         |.||        .|||..:|
Human   384 AGGAGGAGTYHCNLQAMSLYAAGERGGHLQGAPG--------GAGGSAVD 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 58/85 (68%)
FOXC1NP_001444.2 Required for transcriptional activation. /evidence=ECO:0000269|PubMed:11782474 1..51 7/40 (18%)
FH 78..166 CDD:214627 59/87 (68%)
Nuclear localization signal 1 (NLS 1). /evidence=ECO:0000269|PubMed:11782474 78..93 14/14 (100%)
Nuclear localization signal 2 (NLS 2). /evidence=ECO:0000269|PubMed:11782474 168..176 5/7 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..310 16/139 (12%)
Required for transcriptional inhibition. /evidence=ECO:0000269|PubMed:11782474 215..366 27/166 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 356..387 11/30 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 414..465 7/20 (35%)
Required for transcriptional activation. /evidence=ECO:0000269|PubMed:11782474 466..553
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.