DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and FOXF2

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_001443.1 Gene:FOXF2 / 2295 HGNCID:3810 Length:444 Species:Homo sapiens


Alignment Length:358 Identity:115/358 - (32%)
Similarity:159/358 - (44%) Gaps:97/358 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LSPP--------LIKSSRGGSSIGNGIGC-SASSRTAAADAMSMGCDDSDIEPSSMGGSGAAGGN 72
            :|||        ....:...||..:...| |:||.:.:|.|.|..|       .|.||.||..|:
Human    28 MSPPPAAAAAAAAAPETTSSSSSSSSASCASSSSSSNSASAPSAAC-------KSAGGGGAGAGS 85

  Fly    73 GDGSGSSGG---PLVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIR 134
            |....:|.|   | .||||||||||.|||..||.|:||||.|..|:.:|||:::..:..|:||:|
Human    86 GGAKKASSGLRRP-EKPPYSYIALIVMAIQSSPSKRLTLSEIYQFLQARFPFFRGAYQGWKNSVR 149

  Fly   135 HNLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKRAPTMQRFSFPAVFGTL 199
            ||||||:||||:|:..|.||||::||:||.:|.||:.|||.||.:.::                 
Human   150 HNLSLNECFIKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFR----------------- 197

  Fly   200 SPFWIRKPVPLVPVHFNVPNFNGSREFDVVHNPADVFDSALRADKKFNFFANAEASFYQGSQSG- 263
                 ||...|.|::..|.:..|             |.::| ..:.|:|.|...|.....||.| 
Human   198 -----RKCQALKPMYHRVVSGLG-------------FGASL-LPQGFDFQAPPSAPLGCHSQGGY 243

  Fly   264 ------------------------DKFDRLPFMNRGRGADVLDALPHSSG------SGGGVGG-- 296
                                    .....:|.|:...|:..:.:.|..:|      :|||.||  
Human   244 GGLDMMPAGYDAGAGAPSHAHPHHHHHHHVPHMSPNPGSTYMASCPVPAGPGGVGAAGGGGGGDY 308

  Fly   297 GSESSRGSKYKSPYAFDVATVASAAGIPGHRDY 329
            |.:||......||        |.|:.|..|..|
Human   309 GPDSSSSPVPSSP--------AMASAIECHSPY 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 52/85 (61%)
FOXF2NP_001443.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 32..98 19/72 (26%)
FH 100..188 CDD:214627 52/87 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 256..323 15/74 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 338..367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.