DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and FOXF1

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_001442.2 Gene:FOXF1 / 2294 HGNCID:3809 Length:379 Species:Homo sapiens


Alignment Length:374 Identity:112/374 - (29%)
Similarity:152/374 - (40%) Gaps:97/374 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 PSSMGGSGAAGGNGDGSGSSGGPL------------VKPPYSYIALITMAILQSPHKKLTLSGIC 112
            |...||.|..||......:|.||.            .||||||||||.|||..||.|:||||.|.
Human    11 PHGGGGGGGGGGGAAMDPASSGPSKAKKTNAGIRRPEKPPYSYIALIVMAIQSSPTKRLTLSEIY 75

  Fly   113 DFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLRR 177
            .|:.||||:::..:..|:||:|||||||:||||:|:..|.||||::||:||.:|.||:.|||.||
Human    76 QFLQSRFPFFRGSYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRR 140

  Fly   178 RKRYKRA--------PTMQRFSF---PAVFGTL-SPFWIRKPVPLVPVHFNVPNFNGSREFDVVH 230
            .:.::|.        ..|....|   |..:|.. |...:..|...:.:...:...||       |
Human   141 PRGFRRKCQALKPMYSMMNGLGFNHLPDTYGFQGSAGGLSCPPNSLALEGGLGMMNG-------H 198

  Fly   231 NPADVFDSALRADKKFNFFANAEASFYQGSQSG----------DKFDRLPFMNRGRGADVLDALP 285
            .|.:|...||.:....:..:|...| |.|...|          ......|.:..|.|. |::  |
Human   199 LPGNVDGMALPSHSVPHLPSNGGHS-YMGGCGGAAAGEYPHHDSSVPASPLLPTGAGG-VME--P 259

  Fly   286 HSSGSGGGVGGGSESS----RGSKY-------------------------KSPYAFDVATVASA- 320
            |:..||........:|    .|:.|                         :.||....:..|.| 
Human   260 HAVYSGSAAAWPPSASAALNSGASYIKQQPLSPCNPAANPLSGSLSTHSLEQPYLHQNSHNAPAE 324

  Fly   321 -AGIPGHRDYAERL-------------------SAGGG--YMDLNVYND 347
             .|||.:...:..:                   |||||  |.....|.|
Human   325 LQGIPRYHSQSPSMCDRKEFVFSFNAMASSSMHSAGGGSYYHQQVTYQD 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 53/85 (62%)
FOXF1NP_001442.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45 9/33 (27%)
FH 48..136 CDD:214627 53/87 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.