DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and FOXG1

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_005240.3 Gene:FOXG1 / 2290 HGNCID:3811 Length:489 Species:Homo sapiens


Alignment Length:326 Identity:107/326 - (32%)
Similarity:146/326 - (44%) Gaps:65/326 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PPLIKSSRGGSSIGNGIGCSASSRTAAADAMSMGCDDSDIEPSSMGG---SGAAGGNGDGSG--- 77
            ||...::..|:. .:|:|..........:...:|.|:.: :.:..||   .||..|..||.|   
Human   109 PPPPAAALDGAK-ADGLGGKGEPGGGPGELAPVGPDEKE-KGAGAGGEEKKGAGEGGKDGEGGKE 171

  Fly    78 --SSGGPLVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLN 140
              ...|...|||:||.|||.|||.|||.|:|||:||.:|||..||||::....||||||||||||
Human   172 GEKKNGKYEKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLN 236

  Fly   141 DCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSF--LRRRKRYKRAP---------TMQRFSFPA 194
            .||:||||...:|||||:|.|||.::|:|..|:.  ||||....||.         |....:|..
Human   237 KCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSTTSRAKLAFKRGARLTSTGLTFMD 301

  Fly   195 VFGTLSPFWIRKPVPLVPVHFNVPNFNGSREFDVVHNPADVFDSALRADKKFNFFANAEASFYQG 259
            ..|:|  :|     |:.|             |..:|:|        ||....:         |.|
Human   302 RAGSL--YW-----PMSP-------------FLSLHHP--------RASSTLS---------YNG 329

  Fly   260 SQSGDKFDRLPFMNRGRGADVLDALPHSSGSGGGVGGGSESSRGSKYKSPYAFDVATVAS-AAGI 323
            :.|......:|:      :.||......:........|....|....:.|||....|.|: ||.:
Human   330 TTSAYPSHPMPY------SSVLTQNSLGNNHSFSTANGLSVDRLVNGEIPYATHHLTAAALAASV 388

  Fly   324 P 324
            |
Human   389 P 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 56/85 (66%)
FOXG1NP_005240.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..181 16/73 (22%)
FH_FOXG 181..259 CDD:410795 52/77 (68%)
COG5025 <184..>356 CDD:227358 78/214 (36%)
Required for interaction with TLE6. /evidence=ECO:0000250|UniProtKB:Q60987 249..344 34/137 (25%)
Interaction with KDM5B. /evidence=ECO:0000269|PubMed:12657635 383..406 3/7 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 427..455
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.