DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and FOXJ3

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:XP_005270689.1 Gene:FOXJ3 / 22887 HGNCID:29178 Length:630 Species:Homo sapiens


Alignment Length:213 Identity:73/213 - (34%)
Similarity:102/213 - (47%) Gaps:51/213 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TSTD--PMHTLHDSVSLSPPLIKSSRGGSSIGNGIGCSASSRTAAADAMSMGCDDSDIEPSSMGG 65
            ||.|  |..|:..::.      ||....::.|.||    |.:.|..|. :...|..:::....| 
Human    33 TSMDWLPQLTMRAAIQ------KSDATQNAHGTGI----SKKNALLDP-NTTLDQEEVQQHKDG- 85

  Fly    66 SGAAGGNGDGSGSSGGPLVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQ 130
                               ||||||.:|||.||..||.||:|||.|..:|...||||::....|:
Human    86 -------------------KPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWK 131

  Fly   131 NSIRHNLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKRAPTMQRFSFP-- 193
            ||||||||||.||:||||...:||||::|.:|...::     ..|..|.: |||.:::|.|.|  
Human   132 NSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKE-----DVLPTRPK-KRARSVERASTPYS 190

  Fly   194 ----------AVFGTLSP 201
                      .:.|:.||
Human   191 IDSDSLGMECIISGSASP 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 47/85 (55%)
FOXJ3XP_005270689.1 Forkhead 86..163 CDD:278670 46/76 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.