DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and FOXD4L1

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_036316.1 Gene:FOXD4L1 / 200350 HGNCID:18521 Length:408 Species:Homo sapiens


Alignment Length:324 Identity:128/324 - (39%)
Similarity:159/324 - (49%) Gaps:73/324 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 EPSSMGGSGAAGGNGDGSGSSGGPLVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYK 123
            :||..|....|......:........||||||||||||||||||||:|||||||.||..|||||:
Human    81 DPSEFGTEFRAPPRSAAASEDARQPAKPPYSYIALITMAILQSPHKRLTLSGICAFISGRFPYYR 145

  Fly   124 DKFPAWQNSIRHNLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKR----- 183
            .|||||||||||||||||||:|:|||||:||||.:|:|||.::||||||||||||||:||     
Human   146 RKFPAWQNSIRHNLSLNDCFVKIPREPGHPGKGTYWSLDPASQDMFDNGSFLRRRKRFKRHQLTP 210

  Fly   184 -APTMQRFSFPAVFGTL-SPFWIRKPVPLV-------PVHFNVPN-FNGSREFDVVH-NPADVFD 237
             |.....|..||....| :|    :|.||:       ||....|| ..|.|.:.::| :|..   
Human   211 GAHLPHPFPLPAAHAALHNP----RPGPLLGAPALPQPVPGAYPNTAPGRRPYALLHPHPPR--- 268

  Fly   238 SALRADKKFNFFANAEASFYQGSQSGDKFDRLPFMNRGRGADV-----LDALPHSSG-----SGG 292
                       :....|..|.|:.           .:..|||:     |..|..|.|     .|.
Human   269 -----------YLLLSAPAYAGAP-----------KKAEGADLATPGTLPVLQPSLGPQPWEEGK 311

  Fly   293 GV----GGG---------SESSRG-----SKYKSPYAFDVATVASAAGIPGHRDYAERLSAGGG 338
            |:    |||         .:..||     ::..||.|:....:............|...::|||
Human   312 GLASPPGGGCISFSIESIMQGVRGAGTGAAQSLSPTAWSYCPLLQRPSSLSDNFAATAAASGGG 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 70/85 (82%)
FOXD4L1NP_036316.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..54
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 71..104 4/22 (18%)
Forkhead 107..193 CDD:278670 70/85 (82%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 385..408
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm41115
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.