DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and fkh-10

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_492676.2 Gene:fkh-10 / 182874 WormBaseID:WBGene00001442 Length:194 Species:Caenorhabditis elegans


Alignment Length:98 Identity:48/98 - (48%)
Similarity:66/98 - (67%) Gaps:2/98 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 KPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVPRE 149
            ||.:|||.||.||||.||.||:.|:.:.::||:.:||::.:...|:|||||||||||||:|..|.
 Worm    42 KPQHSYIGLIAMAILSSPQKKMVLAEVYEWIMNEYPYFRSRGAGWRNSIRHNLSLNDCFVKAGRA 106

  Fly   150 PGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYK 182
            ..  |||::|.:.|.....|:.|.|.|||.:.|
 Worm   107 AN--GKGHYWAVHPACVKDFERGDFRRRRAQRK 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 42/85 (49%)
fkh-10NP_492676.2 Forkhead 41..125 CDD:365978 41/84 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.