DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and fkh-4

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_510238.2 Gene:fkh-4 / 181466 WormBaseID:WBGene00001436 Length:421 Species:Caenorhabditis elegans


Alignment Length:296 Identity:66/296 - (22%)
Similarity:99/296 - (33%) Gaps:106/296 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 LVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVP 147
            |.:||.||:||..:|...:|..|:|.:|:..|::..:.||:.....|:||:||.||         
 Worm   116 LRRPPISYVALCALACRNAPDMKITPAGVYAFVLHHWRYYRYANENWKNSVRHQLS--------- 171

  Fly   148 REPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKRAPTMQRFSFPAVFGTLSPFWIRKPVPLVP 212
                             :::.||..:|                               :|.|..|
 Worm   172 -----------------SKEHFDEETF-------------------------------QPDPSNP 188

  Fly   213 VHFNVPNFNGSREFDVVHNPADVFDSALRADKKFNFFA--NAEASFYQ---GSQSGDKFDRLP-- 270
                    ...|:|.:|.|| ::....|.:|..|:||.  :....|||   ..|.|     ||  
 Worm   189 --------TVRRKFYIVKNP-NMIRQNLISDADFDFFRKDSRGIEFYQKMFAGQIG-----LPRS 239

  Fly   271 --FMNRGRGADVLDALPHSS------GSGGGVG-----------GGSESSRGSKYKSPYAFDVAT 316
              :...|.|...|....:||      |.|..||           ....::...||:..||.....
 Worm   240 LFYQIIGNGIPFLAGPENSSMFYQLLGMGKVVGYLETRYFREHYRSEHAATEPKYEEDYANFTEK 304

  Fly   317 VASAAGIPGHRDYAERLSAGGGYMDLNVYNDDADTE 352
            :.|         .||.|.:.|...:.|....|...|
 Worm   305 IPS---------NAENLMSYGAATERNFQKFDFTDE 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 22/85 (26%)
fkh-4NP_510238.2 FH 118..206 CDD:214627 32/153 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.