DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and Foxe3

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_599166.1 Gene:Foxe3 / 171302 RGDID:621727 Length:286 Species:Rattus norvegicus


Alignment Length:195 Identity:90/195 - (46%)
Similarity:111/195 - (56%) Gaps:40/195 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 SMGCDDSDIEPSSMGGSGAAGGNGDGSGSSG------GPLV--KPPYSYIALITMAILQSPHKKL 106
            |:..|:...||..:.|    ||:.:...:.|      .||.  ||||||||||.||:..:|.::|
  Rat    25 SLAGDEPGREPEEVVG----GGDSEPPAAPGPGRRRRRPLQRGKPPYSYIALIAMALAHAPGRRL 85

  Fly   107 TLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDN 171
            ||:.|..||..||.:|:|....|||||||||:|||||:|||||||||||||:|||||.|.|||||
  Rat    86 TLAAIYRFITERFAFYRDSPRKWQNSIRHNLTLNDCFVKVPREPGNPGKGNYWTLDPAAADMFDN 150

  Fly   172 GSFLRRRKRYKR------------------------APTMQRFSFPAVFGTLSPFWIRKPVPLVP 212
            |||||||||:||                        ||..:.|...::.|..:    ..|.||.|
  Rat   151 GSFLRRRKRFKRTELPAPPPPPFPYAPFPPAPAPAPAPPARLFRLDSLLGLQT----EPPGPLAP 211

  Fly   213  212
              Rat   212  211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 59/85 (69%)
Foxe3NP_599166.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62 10/40 (25%)
FH 64..152 CDD:214627 61/87 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.