DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and Foxd1

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_599164.2 Gene:Foxd1 / 171299 RGDID:621712 Length:455 Species:Rattus norvegicus


Alignment Length:158 Identity:106/158 - (67%)
Similarity:120/158 - (75%) Gaps:11/158 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SSRTAAADAM----------SMGCDDSDIEPSSMGGSGAAGGNGDGSGSSGGPLVKPPYSYIALI 94
            :||.||:.|.          |.||..:.....:.||.||..|.| |.|||..|||||||||||||
  Rat    76 ASRPAASPAPPGPAPAPGAGSGGCSGAGAGGGAGGGVGAGAGTG-GGGSSKNPLVKPPYSYIALI 139

  Fly    95 TMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVPREPGNPGKGNFW 159
            ||||||||.|:||||.||:||..|||||::|||||||||||||||||||:|:|||||||||||:|
  Rat   140 TMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYW 204

  Fly   160 TLDPLAEDMFDNGSFLRRRKRYKRAPTM 187
            ||||.:.||||||||||||||:||.|.:
  Rat   205 TLDPESADMFDNGSFLRRRKRFKRQPLL 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 71/85 (84%)
Foxd1NP_599164.2 FH_FOXD1_D2-like 130..228 CDD:410820 82/97 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 170 1.000 Domainoid score I3665
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1212
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.780

Return to query results.
Submit another query.