DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and Foxa2

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_001277994.1 Gene:Foxa2 / 15376 MGIID:1347476 Length:465 Species:Mus musculus


Alignment Length:192 Identity:86/192 - (44%)
Similarity:107/192 - (55%) Gaps:34/192 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LSPPLIKSSRGGSSIGNGIGCSASSRTAAADAMSMGCDDSDIEP--SSMGG--SGAAGGNGD-GS 76
            :||.|     .|.|.|.|.....|....||....||   ..:.|  |.:||  :||.||... .:
Mouse    79 MSPSL-----AGMSPGAGAMAGMSGSAGAAGVAGMG---PHLSPSLSPLGGQAAGAMGGLAPYAN 135

  Fly    77 GSSGGPL---------------------VKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFP 120
            .:|..|:                     .|||||||:||||||.|||:|.||||.|..:||..||
Mouse   136 MNSMSPMYGQAGLSRARDPKTYRRSYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFP 200

  Fly   121 YYKDKFPAWQNSIRHNLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYK 182
            :|:.....|||||||:||.||||:||||.|..||||:||||.|.:.:||:||.:|||:||:|
Mouse   201 FYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFK 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 56/85 (66%)
Foxa2NP_001277994.1 Forkhead_N 23..164 CDD:254796 22/92 (24%)
FH 165..253 CDD:214627 57/87 (66%)
DUF4799 <224..319 CDD:292674 24/39 (62%)
HNF_C 381..454 CDD:286443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.