DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and Foxf1

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_034556.2 Gene:Foxf1 / 15227 MGIID:1347470 Length:378 Species:Mus musculus


Alignment Length:337 Identity:109/337 - (32%)
Similarity:146/337 - (43%) Gaps:124/337 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 EPSSMGGSGAAGGNGDGS--GSSGGPL------------VKPPYSYIALITMAILQSPHKKLTLS 109
            :|...||:|..||.|..:  .::.||.            .||||||||||.|||..||.|:||||
Mouse     8 QPPHGGGTGGGGGAGGQAMDPAAAGPTKAKKTNAGVRRPEKPPYSYIALIVMAIQSSPSKRLTLS 72

  Fly   110 GICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSF 174
            .|..|:.:|||:::..:..|:||:|||||||:||||:|:..|.||||::||:||.:|.||:.|||
Mouse    73 EIYQFLQARFPFFRGAYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPASEFMFEEGSF 137

  Fly   175 LRRRKRYKRAPTMQRFSFPAVFGTLSPFWIRKPVPLVPVH--FNVPNFNGSREFDVVHNPADVFD 237
            .||.:.::                      ||...|.||:  .|...||        |.| |.:.
Mouse   138 RRRPRGFR----------------------RKCQALKPVYSMVNGLGFN--------HLP-DTYG 171

  Fly   238 SALRADKKFNFFANAEASFYQGS------------QSGDKFDRLPFMNRGRGADVLD-------A 283
                               :|||            :.|     |..|| |..|..:|       :
Mouse   172 -------------------FQGSGGLSCAPNSLALEGG-----LGMMN-GHLAGNVDGMALPSHS 211

  Fly   284 LPHSSGSG-----GGVGGGSESSRGSKYKSPYAFDVATVASAAGIPGHRD----YAERLSAG-GG 338
            :||...:|     ||.||                      ||||...|.|    .:..|.|| ||
Mouse   212 VPHLPSNGGHSYMGGCGG----------------------SAAGEYPHHDSSVPASPLLPAGAGG 254

  Fly   339 YMDLN-VYNDDA 349
            .|:.: ||:..|
Mouse   255 VMEPHAVYSSSA 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 52/85 (61%)
Foxf1NP_034556.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45 9/36 (25%)
Forkhead 48..133 CDD:306709 51/84 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.