DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and Foxs1

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_034356.1 Gene:Foxs1 / 14239 MGIID:95546 Length:329 Species:Mus musculus


Alignment Length:321 Identity:102/321 - (31%)
Similarity:131/321 - (40%) Gaps:93/321 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 KPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVPRE 149
            ||||||||||.|||..||.::.|||||..:||.||.:|:...|.||||||||||||:||:||||:
Mouse    18 KPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNLSLNECFVKVPRD 82

  Fly   150 PGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRY--------------------------------- 181
            ...||||::|||||...|||.:|||||||:|:                                 
Mouse    83 DRKPGKGSYWTLDPDCHDMFQHGSFLRRRRRFTKRTGAQGTKGPVKIDHRPHRATSPDPGAPKTT 147

  Fly   182 --------KRAPTMQRFSFPAVFGTL------SPFWIRKPVPLVPVHFNVPNFNGSREFDVVHNP 232
                    :..|..:..||..:.|:|      :...:|..:|..|.........|.||.....:|
Mouse   148 TGRLCPFPQEVPNPKGLSFEGLMGSLPANMSSTTSDVRPQLPTGPKEMCSAKSGGPRELSEATSP 212

  Fly   233 ADV----FDSALRADKKFNFFANAEA---------------SFYQGSQSGDKFDRLPFMNRGRGA 278
            :..    |.||         |::||:               |.||        .|:..:|...|.
Mouse   213 SPCPAFGFSSA---------FSDAESLGKAPTPGVAPESVGSSYQ--------CRMQTLNFCMGT 260

  Fly   279 DVLDALPHSSGSGGGVGGGSESSRGSKYKSPYAFDVATVASAAGIPGHRDYAERLSAGGGY 339
            |  ..|.|...|.....|.|..|...:...|...|......|...|        :..|.||
Mouse   261 D--PGLEHLLVSSVPTPGSSTPSASHRAPLPLPADSKEPWVAGSFP--------VQGGSGY 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 56/85 (66%)
Foxs1NP_034356.1 Forkhead 18..103 CDD:278670 55/84 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..150 0/32 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..213 6/38 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.