DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and Foxc2

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_038547.2 Gene:Foxc2 / 14234 MGIID:1347481 Length:494 Species:Mus musculus


Alignment Length:339 Identity:112/339 - (33%)
Similarity:154/339 - (45%) Gaps:102/339 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 SRTAAADAMSMGCDDSDIEPSSMGGSGAAGG--------------NGDGSGSSGGP--------- 82
            :|.:.:|..::|......|.:....:|:.||              .|.|.|.|..|         
Mouse     3 ARYSVSDPNALGVVPYLSEQNYYRAAGSYGGMASPMGVYSGHPEQYGAGMGRSYAPYHHQPAAPK 67

  Fly    83 -LVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKV 146
             ||||||||||||||||..:|.||:||:||..|||.|||:|::....||||||||||||:||:||
Mouse    68 DLVKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNECFVKV 132

  Fly   147 PREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKR-----------------------APTMQ 188
            ||:...||||::|||||.:.:||:||||||||:|:|:                       |||  
Mouse   133 PRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVPKDKEERAHLKEPPSTTAKGAPT-- 195

  Fly   189 RFSFPAVFGTLSPFWIRKPV--------PLVPVHFNVPNFNGSREFDVVHNPADVFDSALRADKK 245
              ..|...|   |....|.|        |.:||...|...:.              :.||:|..:
Mouse   196 --GTPVADG---PKEAEKKVVVKSEAASPALPVITKVETLSP--------------EGALQASPR 241

  Fly   246 FNFFANAEASFYQGSQSGDKFDRLPFMNRGRGADVLDALP-HSSGSGGGVGGGSESSRGSKYKSP 309
                  :.:|...||..|                   :|| |.:.:..|:.|.|..:..:...||
Mouse   242 ------SASSTPAGSPDG-------------------SLPEHHAAAPNGLPGFSVETIMTLRTSP 281

  Fly   310 YAFDVATVASAAGI 323
            ...|::..|:.||:
Mouse   282 PGGDLSPAAARAGL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 57/85 (67%)
Foxc2NP_038547.2 FH 71..159 CDD:214627 58/87 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..213 10/53 (19%)
EBP50_C 167..>257 CDD:286142 21/135 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 233..267 11/58 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 381..422
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.