DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and Foxj1

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_446284.2 Gene:Foxj1 / 116557 RGDID:621764 Length:421 Species:Rattus norvegicus


Alignment Length:439 Identity:120/439 - (27%)
Similarity:147/439 - (33%) Gaps:132/439 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TDPMHTLHDSVSLSPPLIKSSRGGSSIGNGIGCSASSRTAAADAMSMGCDDSDIEPSSMGGSGAA 69
            ||| |..|....|..|       ||.:.....|.....|......|  |......|      |..
  Rat    57 TDP-HGYHQVPGLVAP-------GSPLAADPACLGQPHTPGKPTSS--CTSRSAPP------GLQ 105

  Fly    70 GGNGDGSGSSGGPLVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIR 134
            ....|....:..|.|||||||..||.||:..|...|:|||.|..:|...|.|::...|.||||||
  Rat   106 APPPDDVDYATNPHVKPPYSYATLICMAMQASKATKITLSAIYKWITDNFCYFRHADPTWQNSIR 170

  Fly   135 HNLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKRAPTMQRFSFPAVFGTL 199
            ||||||.||||||||...||||.||.:||...:...:|:|.:||                     
  Rat   171 HNLSLNKCFIKVPREKDEPGKGGFWRIDPQYAERLLSGAFKKRR--------------------- 214

  Fly   200 SPFWIRKPVPLVPVHFNVPNFNGSREFDVVHNPADVFDSALRADKKFNFFANAEASFYQGSQSGD 264
                      |.|||              :| ||               ||...|.....:..|.
  Rat   215 ----------LPPVH--------------IH-PA---------------FARQAAQEPSTAPWGG 239

  Fly   265 KFDRLPFMNRGRGADVLDALPHSSGSGGGVGGGSESSRGSKYKSPYAFDVATV------------ 317
                 |.........:|.....::|.||  .|..|...|.|.|.|....||.|            
  Rat   240 -----PLTVNREAQQLLQEFEEATGEGG--WGTGEGRLGHKRKQPLPKRVAKVLRPPSTLLLTQE 297

  Fly   318 --ASAAGIPGHRDYAERLSAGG----------------------GYMDLNVYNDDADTEA--DAE 356
              .....:.|:.|:.....||.                      |.:||.|:....:..|  ...
  Rat   298 EQGELEPLKGNFDWEAIFEAGALGEELSSLEGLELSPPLSPSSHGEVDLTVHGRHINCPATWGPP 362

  Fly   357 AEGDDDSCE-DKIDVESGNEQEDSHISDSVDSACTNRLDAPPEALIFEA 404
            .|...||.: |:..:.:...|   |..|...|.|     .|||.| |||
  Rat   363 VEQATDSLDFDETFLATSFLQ---HPWDESSSGC-----LPPEPL-FEA 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 48/85 (56%)
Foxj1NP_446284.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..110 6/38 (16%)
FH_FOXJ1 121..199 CDD:410797 46/77 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 256..277 8/22 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.