DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and foxb2

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:XP_004921500.2 Gene:foxb2 / 101730239 XenbaseID:XB-GENE-1021718 Length:317 Species:Xenopus tropicalis


Alignment Length:176 Identity:82/176 - (46%)
Similarity:95/176 - (53%) Gaps:28/176 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 GSSGGPLVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLND 141
            |.|.....|||||||:|..|||..|..|.|.||.|..|||.|||||::....||||:|||||.||
 Frog     5 GKSSYSEQKPPYSYISLTAMAIQSSQEKMLPLSDIYKFIMDRFPYYRENTQRWQNSLRHNLSFND 69

  Fly   142 CFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYK--RAP-----------------TM 187
            ||||:||.|..||||:||.|.|...|||:||||||||||:|  ||.                 ..
 Frog    70 CFIKIPRRPDQPGKGSFWALHPDCGDMFENGSFLRRRKRFKVVRAEHLASKSHQMIHYFHHQHNQ 134

  Fly   188 QRFSFPAVFGTLSPFWIRKPVPLVPVHF---NVPNFNGSREFDVVH 230
            .:...||..|:..|...|.|      ||   |:.|.:||:.....|
 Frog   135 TKLGIPASEGSPVPSLGRLP------HFQPYNIANMSGSQTSGFKH 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 54/85 (64%)
foxb2XP_004921500.2 FH_FOXB2 1..110 CDD:410817 66/104 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.