DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and foxe3

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:XP_002931457.1 Gene:foxe3 / 100495102 XenbaseID:XB-GENE-480592 Length:398 Species:Xenopus tropicalis


Alignment Length:300 Identity:115/300 - (38%)
Similarity:146/300 - (48%) Gaps:70/300 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 TAAADAMSMGCDDSDIEPS--SMGGSGAA--------------GGNG---DGSGSSGG-----PL 83
            |..||:.....:.:...||  ||...|:.              |.||   :.:.:|||     |:
 Frog    14 TMTADSQHSPTEAASPIPSSPSMDSPGSVRVKCEPKGTCSPEEGVNGLPDEHNQASGGRRRKRPI 78

  Fly    84 V--KPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKV 146
            .  ||||||||||.|||..||.:||||.||..|||.|||:|::....|||||||||:|||||:|:
 Frog    79 QRGKPPYSYIALIAMAIANSPERKLTLGGIYKFIMERFPFYRENSKKWQNSIRHNLTLNDCFVKI 143

  Fly   147 PREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKRAPTMQRFSFPAVFGTLSPFWIRKPVPLV 211
            |||||:|||||:|||||.||||||||||||||||:||....   ::|......|.|   .|.|..
 Frog   144 PREPGHPGKGNYWTLDPAAEDMFDNGSFLRRRKRFKRTDLT---TYPGYMQNSSAF---TPTPAG 202

  Fly   212 PVHFNVPNFNG-----SREFDVVHNPADVFDSALRADKKFNFFANAEASFYQ---GSQSGD---- 264
            ...:....::.     :.:....|:||.|                   ..||   |:..|.    
 Frog   203 RASYPTSIYSSVGSGYNPQIHQTHHPAMV-------------------HHYQPPGGAGQGQHRMF 248

  Fly   265 KFDRL----PFMNRGRGADVLDALPHSSGSGGGVGGGSES 300
            ..|.|    ..|....||::..   ||.|..|.:|..:.|
 Frog   249 SIDSLINQQSVMQPSPGAELTH---HSLGLNGDLGNMTSS 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 63/85 (74%)
foxe3XP_002931457.1 FH 82..170 CDD:214627 65/87 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.