DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and foxm1

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:XP_002941428.1 Gene:foxm1 / 100492241 XenbaseID:XB-GENE-854081 Length:754 Species:Xenopus tropicalis


Alignment Length:149 Identity:52/149 - (34%)
Similarity:77/149 - (51%) Gaps:19/149 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 KPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKD-KFPAWQNSIRHNLSLNDCFIKVPR 148
            :|||||:|||..||..:|.|::||..|..:|...|||:|. ..|.|:|||||||||:|.|:   |
 Frog   262 RPPYSYMALIQFAINSTPRKRMTLKDIYTWIEDHFPYFKHVAKPGWKNSIRHNLSLHDMFV---R 323

  Fly   149 EPGNPGKGNFWTLDPLA------EDMFDNGSFLR----RRKRYKRAPTMQRFSFPAVFGT----- 198
            |.....|.::||:.|.|      :.:|.....:.    ..::.|..|.:::....|.:.:     
 Frog   324 ESEANNKVSYWTIHPQANRCLTLDQVFKTAVSMSPADDEPQQKKMIPDIRKSLQSAAYASNKERK 388

  Fly   199 LSPFWIRKPVPLVPVHFNV 217
            :.|...|....|:||||.|
 Frog   389 MKPLLPRVNSYLIPVHFPV 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 41/92 (45%)
foxm1XP_002941428.1 FH 262..337 CDD:238016 38/77 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.