DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and foxl2

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:XP_004917868.1 Gene:foxl2 / 100486124 XenbaseID:XB-GENE-486612 Length:326 Species:Xenopus tropicalis


Alignment Length:267 Identity:101/267 - (37%)
Similarity:126/267 - (47%) Gaps:70/267 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 PLVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKV 146
            |..||||||:|||.|||.:|..|:||||.|..:|:|:||:|:.....||||||||||||:|||||
 Frog    67 PSQKPPYSYVALIAMAIRESAEKRLTLSAIYQYIISKFPFYEKNKKGWQNSIRHNLSLNECFIKV 131

  Fly   147 PREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKRAPTMQRFSFPAVFGTLSPFWIRKPVPLV 211
            |||.|...|||:|||||..||||:.|:: |||:|.||                 ||  |.|    
 Frog   132 PREGGGERKGNYWTLDPACEDMFEKGNY-RRRRRMKR-----------------PF--RPP---- 172

  Fly   212 PVHFNVPNFNGSREFDVVHNPADVFDSALRADKKFNFFANAEASFYQGSQSGDKFDRLPFMNRGR 276
            |.||..    |...|.     :|.:                      |..|..|:.:..|||...
 Frog   173 PTHFQA----GKSLFS-----SDTY----------------------GYLSPPKYLQSTFMNNSW 206

  Fly   277 GADVLDALPHSSGS----GGGVG-----GGSESSRGSKYKSPYAFDV-ATVASAAGIPGHR---- 327
            ......| |.|..|    ||.|.     |.|.||..|.|....:..: :.|.|..|:..|.    
 Frog   207 PLAQPPA-PMSYTSCQMAGGNVSPVNVKGLSASSSYSPYSRVQSMSLPSMVNSYNGMSHHHHPHA 270

  Fly   328 DYAERLS 334
            .:|::||
 Frog   271 HHAQQLS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 57/85 (67%)
foxl2XP_004917868.1 Forkhead 69..155 CDD:365978 56/85 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.