DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and foxd4l1.2

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:XP_002935635.1 Gene:foxd4l1.2 / 100485983 XenbaseID:XB-GENE-876578 Length:338 Species:Xenopus tropicalis


Alignment Length:184 Identity:100/184 - (54%)
Similarity:120/184 - (65%) Gaps:28/184 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHTSTDPMHT-LHDSVSLSPPLIKSSRGGSSIGNGIGCSASSRTAAADAMSMGCDDSDIEPSSMG 64
            :|.:..|.|: :.||..|||..:..:..                        .|..|:   ...|
 Frog    39 LHINQQPTHSEIGDSGVLSPSKLSGTEN------------------------SCHSSE---EKEG 76

  Fly    65 GSGAAGGNGDGSGSSGGPLVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAW 129
            |:.....:......:....:||||||||||||||:|||::|||||||||||.|:|||||||||||
 Frog    77 GTSKDSLHTTPDSKASRAFLKPPYSYIALITMAIVQSPYRKLTLSGICDFISSKFPYYKDKFPAW 141

  Fly   130 QNSIRHNLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKR 183
            ||||||||||||||||:|||||||||||:|||||.::||||||||||||||:||
 Frog   142 QNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPASKDMFDNGSFLRRRKRFKR 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 75/85 (88%)
foxd4l1.2XP_002935635.1 Forkhead 97..182 CDD:365978 74/84 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 178 1.000 Domainoid score I3489
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm48324
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1212
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.020

Return to query results.
Submit another query.