DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and foxk2

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_001135634.1 Gene:foxk2 / 100216193 XenbaseID:XB-GENE-483520 Length:645 Species:Xenopus tropicalis


Alignment Length:208 Identity:78/208 - (37%)
Similarity:99/208 - (47%) Gaps:19/208 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LSPPLIKSSRGGSSIGNGIGCSASSRTAAADAMSMGCDDSDIEPSSMGGSGAAGGNGDGS-GSSG 80
            :||  :.|..|..|..|  .|.:|.|.|.:....:|   ..|.|..:..:..:..:.|.| |.|.
 Frog   157 ISP--LPSPTGTISAAN--SCPSSPRGAGSSGFKLG---RVIPPDLIAEAAQSENDKDASGGDSP 214

  Fly    81 GPLVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIK 145
            ....||||||..||..||..:|.|:|||:||...|...:|||:.....||||||||||||..|||
 Frog   215 KDDSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIK 279

  Fly   146 VPREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKRAPTMQRFSFPAVFGTLSPFWIRKPVPL 210
            |||....||||:||.:||.:|......:|.:||.|          ..|.....|.|...|. .|.
 Frog   280 VPRSQEEPGKGSFWRIDPASESKLVEQAFRKRRPR----------GVPCFRTPLGPLSSRS-APA 333

  Fly   211 VPVHFNVPNFNGS 223
            .|.|..|.:.:.|
 Frog   334 SPNHAGVLSAHSS 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 48/85 (56%)
foxk2NP_001135634.1 FHA 10..117 CDD:238017
Forkhead 218..304 CDD:365978 48/85 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.