DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and foxc1a

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_571803.1 Gene:foxc1a / 100148408 ZFINID:ZDB-GENE-010302-1 Length:476 Species:Danio rerio


Alignment Length:313 Identity:112/313 - (35%)
Similarity:147/313 - (46%) Gaps:88/313 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 LVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVP 147
            :|||||||||||||||..||.||:||:||..|||.|||:|:|....||||||||||||:||:|||
Zfish    72 MVKPPYSYIALITMAIQNSPDKKVTLNGIYQFIMERFPFYRDNKQGWQNSIRHNLSLNECFVKVP 136

  Fly   148 REPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKRAPTM----------------------QRF 190
            |:...||||::|||||.:.:||:||||||||:|:|:...|                      |..
Zfish   137 RDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDAMKDKEDRGVKEAPSRQAQPQAREQEQ 201

  Fly   191 SFP-----------AVFGTLSPFWIRKPVPLVPVHFNVPNF-----NGSREFDVVHN-PADVFDS 238
            |.|           ...||.:|     |..:.|....||..     :.|......|: |:   ..
Zfish   202 SVPGSQPVRIQDIKTENGTSTP-----PQAVSPTLSTVPKIESPDSSSSMSSGSPHSIPS---TR 258

  Fly   239 ALRADKKFNFFANAEASFYQGSQSGDKFDRLPFMNRGRGADVLDALPHSSG---------SGGGV 294
            :|..|       :|....:|....|...|.:  |...||:      |||||         |..|:
Zfish   259 SLSLD-------SAGEQHHQAPAQGFSVDNI--MTSLRGS------PHSSGELTPSLVAPSRTGI 308

  Fly   295 ----GGGSESSRGSKYKSPYAFD-VATVASAAGIPGHRDY-----AERLSAGG 337
                ......::.|.|.||.:.: ::|.::|.       |     |..|.|||
Zfish   309 TPTLSLNYSPNQSSVYSSPCSQNSISTTSNAT-------YHCNMQAMSLYAGG 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 59/85 (69%)
foxc1aNP_571803.1 Forkhead 74..160 CDD:278670 59/85 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 169..271 19/116 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 284..303 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.