DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and foxg1

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_001116933.1 Gene:foxg1 / 100144706 XenbaseID:XB-GENE-480076 Length:432 Species:Xenopus tropicalis


Alignment Length:332 Identity:112/332 - (33%)
Similarity:148/332 - (44%) Gaps:65/332 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PMH-TLHDSVSLSPPLIKSSRGGSSIGNGIGCSASSRTAAADAMSMGCDDSDIEPSSMGGSGAAG 70
            |.| .|.:...|...|::...  .|:..|.|..|:|.....|      .:...:..:.||.|..|
 Frog    52 PHHRPLQEEDELDKSLLEVKT--ESLPPGKGDPAASELPGED------KEKSEDKKADGGGGKDG 108

  Fly    71 GNG-DGSGSSGGPLVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIR 134
            .|| :|.....|...|||:||.|||.|||.|||.|:|||:||.:|||..||||::....||||||
 Frog   109 ENGKEGGEKKNGKYEKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIR 173

  Fly   135 HNLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSF--LRRRKRYKRAP---------TMQ 188
            ||||||.||:||||...:|||||:|.|||.::|:|..|:.  ||||....||.         |..
 Frog   174 HNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSTTSRAKLAFKRGARLTST 238

  Fly   189 RFSFPAVFGTLSPFWIRKPVPLVPVHFNVPNFNGSREFDVVHNPADVFDSALRADKKFNFFANAE 253
            ..:|....|:|  :|     |:.|             |..:|:|        ||         :.
 Frog   239 GLTFMDRAGSL--YW-----PMSP-------------FLSLHHP--------RA---------SS 266

  Fly   254 ASFYQGSQSGDKFDRLPFMNRGRGADVLDALPHSSGSGGGVGGGSESSRGSKYKSPYAFDVATVA 318
            |..|.|:.|......:|:      :.||......|........|....|....:.|||....|.|
 Frog   267 ALSYNGTTSAYPSHPMPY------SSVLTQNSLGSNHSFSTSNGLSVDRLVNGEIPYATHHLTAA 325

  Fly   319 S-AAGIP 324
            : ||.:|
 Frog   326 ALAASVP 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 56/85 (66%)
foxg1NP_001116933.1 FH 124..212 CDD:214627 56/87 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.