DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and foxg1d

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_001116096.1 Gene:foxg1d / 100142648 ZFINID:ZDB-GENE-080305-12 Length:316 Species:Danio rerio


Alignment Length:312 Identity:107/312 - (34%)
Similarity:143/312 - (45%) Gaps:61/312 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 DDSDI-EPSSMGGSGAAGGNGDGSGSSGGP--LVKPPYSYIALITMAILQSPHKKLTLSGICDFI 115
            |.|.: :|.|...|.....:.:.:|.   |  |.|||:||.|||.|||.|||.|:|||:||.:||
Zfish    31 DSSPVTDPPSEERSSEKAKDAEDAGK---PVKLDKPPFSYNALIMMAIRQSPEKRLTLNGIYEFI 92

  Fly   116 MSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSF--LRRR 178
            |..||:|::....||||||||||||.||:||||...:|||||:|.|||.::|:|..|:.  ||||
Zfish    93 MKNFPFYREHKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRR 157

  Fly   179 KRYKRAPTM----QRFSFPAVFGTLSP-----FWIRKPVPLVPVHFNVPNFNGSREFDVVHNPAD 234
            ....|....    .|||...:.|....     :|...|:..:..|.:.|::||:.     |.   
Zfish   158 SATSRGKLAIKRGLRFSPLGLHGITETANNPLYWQLSPLLSLHHHHHHPHYNGTS-----HG--- 214

  Fly   235 VFDSALRADKKFNFFANAEASFYQGSQS-GDKFDRLPFMNRGRGADVLDALPHSSG---SGGGVG 295
                       |...|:...||..|.:. |.:......:....|     ||..|:|   |...||
Zfish   215 -----------FLNQAHGYGSFVHGVEHLGSREAPRAVLGGSSG-----ALGLSNGYGMSSSPVG 263

  Fly   296 -----------GGSESSRGSKYKSPYAFDVATVASAAGIP--GHRDYAERLS 334
                       .|.:|:.|:......|....|...||.:|  .|.|   |||
Zfish   264 LLSVPSGLLPAPGLQSALGAPQSLRTALGPFTPTGAAALPALAHHD---RLS 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 55/85 (65%)
foxg1dNP_001116096.1 FH 62..150 CDD:214627 55/87 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.